bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_8567_orf2 Length=132 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_080380 non-transmembrane antigen (EC:3.2.1.143); K0... 107 1e-23 cel:H22D14.1 nhr-267; Nuclear Hormone Receptor family member (... 33.9 0.13 cel:F14A5.1 nhr-264; Nuclear Hormone Receptor family member (n... 33.1 0.20 xla:734659 parg, MGC115697; poly (ADP-ribose) glycohydrolase; ... 32.0 0.45 cel:C45E1.1 nhr-64; Nuclear Hormone Receptor family member (nh... 30.8 1.2 cpv:cgd5_2130 chromatin associated proein with a chromodomain ... 30.0 1.9 sce:YDR499W LCD1, DDC2, PIE1; Essential protein required for t... 29.3 3.4 ath:AT2G24630 ATCSLC08; cellulose synthase/ transferase, trans... 28.9 4.9 > tgo:TGME49_080380 non-transmembrane antigen (EC:3.2.1.143); K07759 poly(ADP-ribose) glycohydrolase [EC:3.2.1.143] Length=553 Score = 107 bits (267), Expect = 1e-23, Method: Compositional matrix adjust. Identities = 55/148 (37%), Positives = 84/148 (56%), Gaps = 17/148 (11%) Query 2 GNWRVDKPLRI---GPLTHHLATHKNLSKSLLPFLASLARRLPDFFPSGIRHLGRDNPAV 58 GN R +K RI G L + LPF+A+L R+ + FPSG++++ +NP V Sbjct 91 GNIRTEKNKRILQRGLLNYLEENPGKFFSHDLPFMATLVMRIDELFPSGLQYITPENPQV 150 Query 59 HLRRIEVLALLAALFFGIV--------------YPLQMNAPDMHYRGFFERPPKYQSLLQ 104 HLR+I+V L+AA F G++ + + N DM YRGF ER PK+QS+L Sbjct 151 HLRKIQVFTLIAAAFLGVIPHNQRALLAHHQKKFVMNQNKLDMFYRGFMERKPKFQSVLI 210 Query 105 YFQQMQQTVGSCWQQMLQRGDVGPLRCS 132 YF M++ +G+CW +M+++G V C+ Sbjct 211 YFASMRERLGNCWNEMVKKGFVDMAPCT 238 > cel:H22D14.1 nhr-267; Nuclear Hormone Receptor family member (nhr-267) Length=344 Score = 33.9 bits (76), Expect = 0.13, Method: Compositional matrix adjust. Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 1/66 (1%) Query 56 PAVH-LRRIEVLALLAALFFGIVYPLQMNAPDMHYRGFFERPPKYQSLLQYFQQMQQTVG 114 P V+ L + +V LL F V+ + A M +E PK + L +Y QQ++ T+G Sbjct 204 PGVNSLEKEDVQTLLKYFQFANVWMDSVRAYSMSNVDIYETTPKDKRLSEYIQQVKLTLG 263 Query 115 SCWQQM 120 S + Q+ Sbjct 264 SSFSQL 269 > cel:F14A5.1 nhr-264; Nuclear Hormone Receptor family member (nhr-264) Length=408 Score = 33.1 bits (74), Expect = 0.20, Method: Composition-based stats. Identities = 21/66 (31%), Positives = 34/66 (51%), Gaps = 1/66 (1%) Query 56 PAVH-LRRIEVLALLAALFFGIVYPLQMNAPDMHYRGFFERPPKYQSLLQYFQQMQQTVG 114 P V+ L + +V LL F V+ + A M +E PK + L +Y QQ++ T+G Sbjct 254 PGVNSLEKEDVQTLLKYFQFANVWMDSVRAYSMSNVDIYETTPKDKRLSEYIQQVKLTLG 313 Query 115 SCWQQM 120 S + Q+ Sbjct 314 SSFSQL 319 > xla:734659 parg, MGC115697; poly (ADP-ribose) glycohydrolase; K07759 poly(ADP-ribose) glycohydrolase [EC:3.2.1.143] Length=759 Score = 32.0 bits (71), Expect = 0.45, Method: Composition-based stats. Identities = 27/107 (25%), Positives = 54/107 (50%), Gaps = 17/107 (15%) Query 20 ATHKNLSKSLLPFLASLARRLPDFFPSGIRHLGRD-NPAVHLRRIEVLALLAALFFGIVY 78 A + +L S+LP + +LA LP+ L + N ++ + ++++ +LLA FF + Sbjct 381 AEYDHLFHSILPDMVNLALSLPNICTQPTPLLKQKMNHSITMSQMQIASLLANAFF-CTF 439 Query 79 PLQMNA---------PDMHYRGFFE-----RPPKYQSLLQYFQQMQQ 111 P + NA PD+++ FE + K ++L YF+++ + Sbjct 440 P-RRNARMKSEYSSYPDINFNRLFEGKNPKKAEKLKTLFCYFRRVTE 485 > cel:C45E1.1 nhr-64; Nuclear Hormone Receptor family member (nhr-64); K07295 nuclear receptor subfamily 2 group A Length=369 Score = 30.8 bits (68), Expect = 1.2, Method: Compositional matrix adjust. Identities = 28/94 (29%), Positives = 41/94 (43%), Gaps = 16/94 (17%) Query 15 LTHHLATHKNLSKSLLPFLASLARRLPDFFPSGIRHLGRDNPAVHLRRIEVLALLAALFF 74 LT+ HK+ K +P + +A R+ D + +R L H+ IE +AL A FF Sbjct 216 LTNETCLHKDSPK--IPDMNRVAERIIDQVTNPMRSL-------HMNEIEYIALKAIAFF 266 Query 75 -----GIVYPLQMNAPDMHYRGF--FERPPKYQS 101 GI + +M R FER +Y S Sbjct 267 DPLAKGITSESYSDVEEMRQRILESFERHVRYVS 300 > cpv:cgd5_2130 chromatin associated proein with a chromodomain at the C-terminus Length=1075 Score = 30.0 bits (66), Expect = 1.9, Method: Composition-based stats. Identities = 14/41 (34%), Positives = 20/41 (48%), Gaps = 0/41 (0%) Query 6 VDKPLRIGPLTHHLATHKNLSKSLLPFLASLARRLPDFFPS 46 + P+ + P THH+ K LS S L S+ R P + S Sbjct 494 IQNPIILAPKTHHMIVKKALSNSRYWSLDSITSRCPQSYTS 534 > sce:YDR499W LCD1, DDC2, PIE1; Essential protein required for the DNA integrity checkpoint pathways; interacts physically with Mec1p; putative homolog of S. pombe Rad26 and human ATRIP; K12578 DNA damage checkpoint protein LCD1 Length=747 Score = 29.3 bits (64), Expect = 3.4, Method: Composition-based stats. Identities = 14/41 (34%), Positives = 21/41 (51%), Gaps = 0/41 (0%) Query 12 IGPLTHHLATHKNLSKSLLPFLASLARRLPDFFPSGIRHLG 52 I L ++ H N SK +PFL +L ++ F PS +L Sbjct 278 IAVLIKEISVHPNESKLAVPFLVALMYQIVQFRPSATHNLA 318 > ath:AT2G24630 ATCSLC08; cellulose synthase/ transferase, transferring glycosyl groups Length=690 Score = 28.9 bits (63), Expect = 4.9, Method: Composition-based stats. Identities = 27/85 (31%), Positives = 37/85 (43%), Gaps = 19/85 (22%) Query 32 FLASLARRLPDFFPSGIRHLGRDNPAVHLRRIEVLALLAALFFGIVYPLQMNAPDMHYRG 91 L S+ RRL P G LGRD ++ ++A LA L F +V +YRG Sbjct 81 LLGSVKRRLSFTHPLGSERLGRDGWLFSAIKLFLVASLAILAFELV---------AYYRG 131 Query 92 --FFERPP--------KYQSLLQYF 106 +F+ P + QSLL F Sbjct 132 WHYFKNPNLHIPTSKLEIQSLLHLF 156 Lambda K H 0.328 0.143 0.460 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 2099897216 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40