bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 164,496 sequences; 82,071,388 total letters Query= Eten_8597_orf1 Length=176 Score E Sequences producing significant alignments: (Bits) Value tgo:TGME49_089330 ubiquitin carboxyl-terminal hydrolase, putat... 91.7 1e-18 pfa:MAL7P1.147 ubiquitin carboxyl-terminal hydrolase, putative... 62.8 6e-10 bbo:BBOV_IV001730 21.m03027; ubiquitin carboxyl-terminal hydro... 57.4 2e-08 cpv:cgd8_1530 ubiquitin carboxyl terminal hydrolase domain tha... 48.5 1e-05 tpv:TP03_0494 ubiquitin carboxyl-terminal hydrolase (EC:3.1.2.... 47.4 2e-05 mmu:56457 Clptm1, HS9, N14; cleft lip and palate associated tr... 30.4 3.2 hsa:64852 TUT1, FLJ21850, FLJ22267, FLJ22347, MGC131987, MGC14... 30.4 3.5 ath:AT1G08060 MOM; MOM (MORPHEUS MOLECULE) 29.6 5.8 ath:AT1G75730 hypothetical protein 29.3 6.9 dre:100334413 enzymatic polyprotein; Endonuclease; Reverse tra... 29.3 7.5 dre:561360 hypothetical LOC561360 28.9 9.7 > tgo:TGME49_089330 ubiquitin carboxyl-terminal hydrolase, putative (EC:1.1.3.12 3.1.2.15); K11838 ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15] Length=2100 Score = 91.7 bits (226), Expect = 1e-18, Method: Compositional matrix adjust. Identities = 47/77 (61%), Positives = 54/77 (70%), Gaps = 9/77 (11%) Query 7 NYLRGE---------RKPRTRNKPYNAYILVYVNKTLAPSLLADCSPLKVNPQILSRCRT 57 NYL GE R PR+R K YNAYILVYV K LA LLADC+P+KVNPQ++ RCRT Sbjct 819 NYLAGEFRFFRLQSSRAPRSRQKVYNAYILVYVKKRLANQLLADCNPMKVNPQVVIRCRT 878 Query 58 EEQLRRLRTSIRNVLEK 74 EE L +LR IR VLE+ Sbjct 879 EELLMKLRNRIRRVLEQ 895 > pfa:MAL7P1.147 ubiquitin carboxyl-terminal hydrolase, putative (EC:3.1.2.15); K11838 ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15] Length=3183 Score = 62.8 bits (151), Expect = 6e-10, Method: Composition-based stats. Identities = 28/61 (45%), Positives = 42/61 (68%), Gaps = 1/61 (1%) Query 14 KPRTRNKPYNAYILVYVNKTLAPSLLADCSPLKVNPQILSRCRTEEQLRRLRTSIRN-VL 72 K + R K Y+AY+LVYV K+L P L+ +C P VNPQ++ RCR EE + + R +++ +L Sbjct 1181 KIKQRLKNYSAYMLVYVKKSLIPKLIKECDPAVVNPQVVKRCRLEEIINKKRYKLKDEIL 1240 Query 73 E 73 E Sbjct 1241 E 1241 > bbo:BBOV_IV001730 21.m03027; ubiquitin carboxyl-terminal hydrolase; K11838 ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15] Length=1446 Score = 57.4 bits (137), Expect = 2e-08, Method: Composition-based stats. Identities = 30/73 (41%), Positives = 40/73 (54%), Gaps = 4/73 (5%) Query 4 ECYNYLRGER----KPRTRNKPYNAYILVYVNKTLAPSLLADCSPLKVNPQILSRCRTEE 59 +CYNY E K R K YNAYIL+YV K +L C P+K + +++RC EE Sbjct 561 DCYNYCESEDNASVKAFRRPKNYNAYILIYVLKDAVDDILGPCDPVKEHYSMITRCSLEE 620 Query 60 QLRRLRTSIRNVL 72 +L LR +R L Sbjct 621 RLYNLRHRVRERL 633 > cpv:cgd8_1530 ubiquitin carboxyl terminal hydrolase domain that is fused to a MATH domain ; K11838 ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15] Length=1607 Score = 48.5 bits (114), Expect = 1e-05, Method: Composition-based stats. Identities = 27/72 (37%), Positives = 43/72 (59%), Gaps = 1/72 (1%) Query 4 ECYNYL-RGERKPRTRNKPYNAYILVYVNKTLAPSLLADCSPLKVNPQILSRCRTEEQLR 62 E ++YL E R+K ++AYILVYV + A LL++ P +VNP ++S+ R E ++ Sbjct 648 EVWDYLGNPESDIPKRSKTHSAYILVYVREDQAQDLLSEPIPQEVNPDLVSKYRKEIEMM 707 Query 63 RLRTSIRNVLEK 74 LR +R L + Sbjct 708 NLRKRLRQDLNE 719 > tpv:TP03_0494 ubiquitin carboxyl-terminal hydrolase (EC:3.1.2.15); K11838 ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15] Length=1062 Score = 47.4 bits (111), Expect = 2e-05, Method: Composition-based stats. Identities = 29/79 (36%), Positives = 38/79 (48%), Gaps = 10/79 (12%) Query 4 ECYNYL----------RGERKPRTRNKPYNAYILVYVNKTLAPSLLADCSPLKVNPQILS 53 +CYNY R+K YNAYIL+YV K+ +L + LK N Q+LS Sbjct 654 DCYNYFTTNPSNPSIYSNHMNRYRRSKVYNAYILIYVLKSKKDEILGEVDMLKENYQMLS 713 Query 54 RCRTEEQLRRLRTSIRNVL 72 R R + L LR+ R L Sbjct 714 RYRIQRLLHCLRSKTRERL 732 > mmu:56457 Clptm1, HS9, N14; cleft lip and palate associated transmembrane protein 1 Length=664 Score = 30.4 bits (67), Expect = 3.2, Method: Composition-based stats. Identities = 15/37 (40%), Positives = 20/37 (54%), Gaps = 0/37 (0%) Query 89 PLPGTAVPVCDSDTGPKAQSGQPAAAAARDDKPRAHE 125 P P TAV D+ T PKA SG A+ ++ P+ E Sbjct 623 PAPSTAVSGEDASTVPKATSGACTASQPQEAPPKPAE 659 > hsa:64852 TUT1, FLJ21850, FLJ22267, FLJ22347, MGC131987, MGC149809, PAPD2, RBM21, STARPAP, TUTase; terminal uridylyl transferase 1, U6 snRNA-specific (EC:2.7.7.19 2.7.7.52) Length=912 Score = 30.4 bits (67), Expect = 3.5, Method: Compositional matrix adjust. Identities = 24/78 (30%), Positives = 33/78 (42%), Gaps = 1/78 (1%) Query 77 GQGLPPAAVQVPPLPGTAVPVCDSDTGPKAQSGQPAAAAARDDKPRAHEAALRRRGQLEG 136 G+ + A+Q P PG +P+ G + GQP+ AA + P+ HEAA G Sbjct 735 GEMVQDWAMQSPGQPGD-LPLTTGKHGAPGEEGQPSHAALAERGPKGHEAAQEWSQGEAG 793 Query 137 VPGVLRVSVSGFSGEWRR 154 L S S W R Sbjct 794 KGASLPSSASWRCALWHR 811 > ath:AT1G08060 MOM; MOM (MORPHEUS MOLECULE) Length=2001 Score = 29.6 bits (65), Expect = 5.8, Method: Compositional matrix adjust. Identities = 24/89 (26%), Positives = 43/89 (48%), Gaps = 5/89 (5%) Query 6 YNYLRGERKPRTRNKPYNAYILVYVNKTLAPSLLADCSPLKVNPQILSRCRTEEQLRRLR 65 ++ + E RT K LV +NK LA + L+ C+ KV+P R + ++ +R Sbjct 1780 FHEVEAEHNTRT-TKIEKDKNLVIMNKLLANAFLSKCTDKKVSPSGAPRGKIQQLAQRAA 1838 Query 66 --TSIRNVL--EKCQGQGLPPAAVQVPPL 90 +++RN + ++ Q P A+ PL Sbjct 1839 QVSALRNYIAPQQLQASSFPAPALVSAPL 1867 > ath:AT1G75730 hypothetical protein Length=589 Score = 29.3 bits (64), Expect = 6.9, Method: Composition-based stats. Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 3/49 (6%) Query 19 NKPYNAYILVYVNKTLAPS---LLADCSPLKVNPQILSRCRTEEQLRRL 64 +KP + + ++ + ++PS L +C PL+V P+ L RC + + RL Sbjct 281 SKPSSTKLPPWMGQAVSPSNTASLLNCEPLRVQPRKLKRCASHIYISRL 329 > dre:100334413 enzymatic polyprotein; Endonuclease; Reverse transcriptase, putative-like Length=1766 Score = 29.3 bits (64), Expect = 7.5, Method: Compositional matrix adjust. Identities = 21/56 (37%), Positives = 27/56 (48%), Gaps = 2/56 (3%) Query 43 SPLKVNPQILSRCRTEEQLRRLRTSIRNVLEKCQGQGLPPAAVQVPPLPGTAVPVC 98 SP +V Q L +EE L+RL ++ G G+ P Q PP P T VP C Sbjct 997 SPTRVIKQ-LKENHSEEWLQRLARYTTQCVDFLSGPGVLPITFQEPPAP-TVVPSC 1050 > dre:561360 hypothetical LOC561360 Length=1047 Score = 28.9 bits (63), Expect = 9.7, Method: Composition-based stats. Identities = 16/51 (31%), Positives = 22/51 (43%), Gaps = 0/51 (0%) Query 77 GQGLPPAAVQVPPLPGTAVPVCDSDTGPKAQSGQPAAAAARDDKPRAHEAA 127 G+ P Q+P P VP +S T P Q+ Q A D+P +A Sbjct 967 GKITPVRPTQIPQRPTWTVPTPNSPTSPTNQNQQTAPRIKPPDQPNVSRSA 1017 Lambda K H 0.317 0.134 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 4600750868 Database: egene_temp_file_orthology_annotation_similarity_blast_database_866 Posted date: Sep 17, 2011 2:57 PM Number of letters in database: 82,071,388 Number of sequences in database: 164,496 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40