bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Emax_0555_orf1 Length=99 Score E Sequences producing significant alignments: (Bits) Value 7955.ENSDARP00000092438 34.7 0.95 316056.RPC_1314 33.1 2.8 > 7955.ENSDARP00000092438 Length=407 Score = 34.7 bits (78), Expect = 0.95, Method: Compositional matrix adjust. Identities = 28/83 (33%), Positives = 41/83 (49%), Gaps = 1/83 (1%) Query 7 SSSERQDSSSTAVAAVAAALQQHSYVVARIAPLAAACADLQLWRSRSRTVGPAAAAAAGS 66 S SE +D ++AV++V A+ +Q SY+ ARI L A C LQ + S S V +A + Sbjct 31 SFSEGRDLITSAVSSVKASAKQGSYISARIT-LGALCHTLQDFYSHSNWVELGNSAPFST 89 Query 67 AAVSEYPSREAPRLALEDGPACS 89 E P L+ AC+ Sbjct 90 LIKPELPLDNVADLSTPTCKACT 112 > 316056.RPC_1314 Length=530 Score = 33.1 bits (74), Expect = 2.8, Method: Compositional matrix adjust. Identities = 15/53 (28%), Positives = 25/53 (47%), Gaps = 0/53 (0%) Query 47 QLWRSRSRTVGPAAAAAAGSAAVSEYPSREAPRLALEDGPACSSSSTFPLSMG 99 Q+ R S+ +G A + + +YP+R AP++ E + PL MG Sbjct 370 QMERHISKRLGVPCAVISAPVHIQDYPARYAPQMGFEGANVIFDTWVHPLMMG 422 Lambda K H 0.310 0.117 0.320 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 23144316443 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40