bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: eggV2 2,483,276 sequences; 915,453,621 total letters Query= Eten_0010_orf3 Length=168 Score E Sequences producing significant alignments: (Bits) Value 10116.ENSRNOP00000039248 35.8 0.51 8090.ENSORLP00000006641 33.9 1.7 > 10116.ENSRNOP00000039248 Length=475 Score = 35.8 bits (81), Expect = 0.51, Method: Compositional matrix adjust. Identities = 31/88 (35%), Positives = 39/88 (44%), Gaps = 1/88 (1%) Query 5 LISCCSWGVCTPHQLLQL-GCVSTSAAAAGVSVHLLSCCSWGVYTPPQLLHLRCLYTSRA 63 L CCS PH+LL L C S+ AA + L C S TP +LL L Y+S+ Sbjct 375 LTDCCSSQTAAPHRLLLLTDCYSSQTAAPHRLLLLTDCYSSQTATPHRLLLLTDCYSSQT 434 Query 64 AAAGVSTHLNICCGCCCCSWGVCTPQCL 91 AA + + CCS TP L Sbjct 435 AAPQTAAPHRLLLLTDCCSSQTATPHRL 462 > 8090.ENSORLP00000006641 Length=2096 Score = 33.9 bits (76), Expect = 1.7, Method: Composition-based stats. Identities = 22/57 (38%), Positives = 29/57 (50%), Gaps = 4/57 (7%) Query 19 LLQLGCVSTSAA-AAGVSVHLLSCCSWGVYTPPQLLHLRCLYTSRAAAAGVSTHLNI 74 ++Q G +ST+A V V C + V PP LR LY SR AAG+ T L + Sbjct 2003 VVQAGTLSTAAVLMKNVGV---DTCRFHVKQPPLATGLRVLYNSRPVAAGLQTELKV 2056 Lambda K H 0.330 0.134 0.506 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 30377245073 Database: eggV2 Posted date: Dec 15, 2009 4:47 PM Number of letters in database: 915,453,621 Number of sequences in database: 2,483,276 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40