bitscore colors: <40, 40-50 , 50-80, 80-200, >200

BLASTP 2.2.24+
Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A.
Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J.
Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of
protein database search programs", Nucleic Acids Res. 25:3389-3402.
Reference for composition-based statistics: Alejandro A. Schaffer,
L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri
I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001),
"Improving the accuracy of PSI-BLAST protein database searches with
composition-based statistics and other refinements", Nucleic Acids
Res. 29:2994-3005.
Database: eggV2
2,483,276 sequences; 915,453,621 total letters
Query= Eten_0010_orf3
Length=168
Score E
Sequences producing significant alignments: (Bits) Value
10116.ENSRNOP00000039248 35.8 0.51
8090.ENSORLP00000006641 33.9 1.7
> 10116.ENSRNOP00000039248
Length=475
Score = 35.8 bits (81), Expect = 0.51, Method: Compositional matrix adjust.
Identities = 31/88 (35%), Positives = 39/88 (44%), Gaps = 1/88 (1%)
Query 5 LISCCSWGVCTPHQLLQL-GCVSTSAAAAGVSVHLLSCCSWGVYTPPQLLHLRCLYTSRA 63
L CCS PH+LL L C S+ AA + L C S TP +LL L Y+S+
Sbjct 375 LTDCCSSQTAAPHRLLLLTDCYSSQTAAPHRLLLLTDCYSSQTATPHRLLLLTDCYSSQT 434
Query 64 AAAGVSTHLNICCGCCCCSWGVCTPQCL 91
AA + + CCS TP L
Sbjct 435 AAPQTAAPHRLLLLTDCCSSQTATPHRL 462
> 8090.ENSORLP00000006641
Length=2096
Score = 33.9 bits (76), Expect = 1.7, Method: Composition-based stats.
Identities = 22/57 (38%), Positives = 29/57 (50%), Gaps = 4/57 (7%)
Query 19 LLQLGCVSTSAA-AAGVSVHLLSCCSWGVYTPPQLLHLRCLYTSRAAAAGVSTHLNI 74
++Q G +ST+A V V C + V PP LR LY SR AAG+ T L +
Sbjct 2003 VVQAGTLSTAAVLMKNVGV---DTCRFHVKQPPLATGLRVLYNSRPVAAGLQTELKV 2056
Lambda K H
0.330 0.134 0.506
Gapped
Lambda K H
0.267 0.0410 0.140
Effective search space used: 30377245073
Database: eggV2
Posted date: Dec 15, 2009 4:47 PM
Number of letters in database: 915,453,621
Number of sequences in database: 2,483,276
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Neighboring words threshold: 11
Window for multiple hits: 40