bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eace_0370_orf1 Length=121 Score E Sequences producing significant alignments: (Bits) Value 7291408 31.2 0.55 Hs4504951 28.5 3.4 CE02271 28.1 3.7 Hs22047474 28.1 4.0 Hs6912446 27.7 4.8 Hs22043104 27.7 5.1 At5g40480 27.7 5.9 7294936 27.7 6.1 7301208 27.3 8.0 Hs22047832 26.9 8.6 > 7291408 Length=1013 Score = 31.2 bits (69), Expect = 0.55, Method: Compositional matrix adjust. Identities = 20/51 (39%), Positives = 29/51 (56%), Gaps = 1/51 (1%) Query 6 DWSCVSWSCCSL-PDSAVLVASSELRSTGHLFSRSPSLPPSASSASSSSVK 55 D +C + C ++ PDS LV+S + G RSP+L P S+A S SV+ Sbjct 437 DGTCDNGPCITVDPDSISLVSSQNMYQFGTPKERSPTLSPLNSAAYSRSVE 487 > Hs4504951 Length=1786 Score = 28.5 bits (62), Expect = 3.4, Method: Compositional matrix adjust. Identities = 29/117 (24%), Positives = 45/117 (38%), Gaps = 27/117 (23%) Query 25 ASSELRSTGHLFSRSPSLPPSASSASSS-SVKFESAASLSSVTTREL------------- 70 A+ L++ G+LF + L + + VK S S+ T +EL Sbjct 1239 AAEPLKNIGNLFEEAEKLIKDVTEMMAQVEVKLSDTTSQSNSTAKELDSLQTEAESLDNT 1298 Query 71 -------------SELKEGLRSACGLVRHHLTSEDEPGCSTDEPDSPVELSALSSSR 114 S+++ L S + L +E+ ST EP+S VE SAL R Sbjct 1299 VKELAEQLEFIKNSDIRGALDSITKYFQMSLEAEERVNASTTEPNSTVEQSALMRDR 1355 > CE02271 Length=1696 Score = 28.1 bits (61), Expect = 3.7, Method: Composition-based stats. Identities = 19/82 (23%), Positives = 36/82 (43%), Gaps = 0/82 (0%) Query 32 TGHLFSRSPSLPPSASSASSSSVKFESAASLSSVTTRELSELKEGLRSACGLVRHHLTSE 91 + HLF ++PP S SS + SS ++ + ++ L + +R+ Sbjct 224 SNHLFQIVKAVPPEKLSCSSLTAWISLVKITSSEVLSQVHDAQQVLTNMIAHIRNETDWS 283 Query 92 DEPGCSTDEPDSPVELSALSSS 113 D+ C T + V L +++SS Sbjct 284 DQAMCGTLQLACAVALKSIASS 305 > Hs22047474 Length=662 Score = 28.1 bits (61), Expect = 4.0, Method: Compositional matrix adjust. Identities = 16/30 (53%), Positives = 19/30 (63%), Gaps = 0/30 (0%) Query 18 PDSAVLVASSELRSTGHLFSRSPSLPPSAS 47 PD AV ASS+ S GH +R P LPP +S Sbjct 241 PDWAVSKASSDFTSQGHSKAREPPLPPHSS 270 > Hs6912446 Length=1017 Score = 27.7 bits (60), Expect = 4.8, Method: Compositional matrix adjust. Identities = 26/84 (30%), Positives = 33/84 (39%), Gaps = 15/84 (17%) Query 36 FSRSPSLP------------PSASSASSSSVKFESAASLSSVTTR---ELSELKEGLRSA 80 FSR P LP PS AS + E L+ +R E+S+L LR Sbjct 845 FSRRPELPRPRSQAPPTGTRPSPELASEAEEVKEKVCRLNQEISRLNQEVSQLSRELRHI 904 Query 81 CGLVRHHLTSEDEPGCSTDEPDSP 104 GL++ L P S PD P Sbjct 905 MGLLQARLGPPGHPAGSAWTPDPP 928 > Hs22043104 Length=1279 Score = 27.7 bits (60), Expect = 5.1, Method: Compositional matrix adjust. Identities = 24/73 (32%), Positives = 34/73 (46%), Gaps = 4/73 (5%) Query 14 CCSLPDSAVLVASSELRSTGHLFSRSPSLPPSASSASSSSVK---FESAASLSSVTTREL 70 C LP A V +SEL GH +S +L S SV + S V R++ Sbjct 177 CLPLPRLAAAVCTSELEEAGHWWSLDWALQGGDSWLQPGSVDTLALSGQSRQSPVFLRDV 236 Query 71 SELKEG-LRSACG 82 +E +EG +R+A G Sbjct 237 TEAQEGPMRAAMG 249 > At5g40480 Length=1919 Score = 27.7 bits (60), Expect = 5.9, Method: Compositional matrix adjust. Identities = 13/29 (44%), Positives = 17/29 (58%), Gaps = 0/29 (0%) Query 15 CSLPDSAVLVASSELRSTGHLFSRSPSLP 43 LP +A+LVA S+ + GH SPS P Sbjct 1223 VGLPATAMLVAQSDTVAVGHEMPVSPSFP 1251 > 7294936 Length=647 Score = 27.7 bits (60), Expect = 6.1, Method: Compositional matrix adjust. Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 0/33 (0%) Query 39 SPSLPPSASSASSSSVKFESAASLSSVTTRELS 71 P+LP SS++V+ +SA + S VT R+L+ Sbjct 410 QPALPKLVLQNSSTNVRLKSAGNQSKVTKRQLT 442 > 7301208 Length=1654 Score = 27.3 bits (59), Expect = 8.0, Method: Composition-based stats. Identities = 25/91 (27%), Positives = 35/91 (38%), Gaps = 9/91 (9%) Query 16 SLPDSAVLVASSELRSTGHLFSRSPSLPPSASSASSSSVKFESAASLSSVTTRELSELKE 75 +LP+ V V S G F + S PP +S V E L R +S KE Sbjct 1015 NLPEKDVYVCESRYNIQGRWFKKLKSWPPVREGSSVKFVPREQPLELK----RVMSVFKE 1070 Query 76 GLRSACG-----LVRHHLTSEDEPGCSTDEP 101 L G ++ L +++P S D P Sbjct 1071 RLEKHKGELEELKLQETLVEKEKPNVSCDPP 1101 > Hs22047832 Length=656 Score = 26.9 bits (58), Expect = 8.6, Method: Compositional matrix adjust. Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 0/35 (0%) Query 23 LVASSELRSTGHLFSRSPSLPPSASSASSSSVKFE 57 L AS+ ++ T L+++ + P SAS A+ SVK E Sbjct 302 LTASASVQYTAMLYTKGQTTPKSASGAARRSVKTE 336 Lambda K H 0.305 0.118 0.337 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1198419392 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40