bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eace_2215_orf1 Length=76 Score E Sequences producing significant alignments: (Bits) Value Hs4557709 35.0 0.031 CE08071 33.1 0.12 CE02186 31.6 0.38 7290500 30.8 0.70 Hs6005904 29.6 1.4 At4g24520 28.9 2.3 7297839_2 28.9 2.4 Hs13699824 28.5 3.4 Hs21264594 28.5 3.5 At1g59620 28.5 3.5 Hs7706639 28.1 3.8 Hs21264592 28.1 3.8 HsM16975482 28.1 3.8 7290995 28.1 3.8 Hs18563640 28.1 3.9 At1g03080 28.1 4.1 CE25049 28.1 4.2 At1g63300 28.1 4.3 Hs21237794 28.1 4.3 HsM7661944 28.1 4.4 CE17275 28.1 4.5 7299228 27.7 5.1 YGR089w 27.7 5.3 Hs4502767 27.7 5.4 CE19350 27.7 5.4 At5g42570 27.7 5.6 SPAC186.05c 27.3 6.7 CE07133 27.3 7.5 CE05442 26.9 8.2 Hs17485914 26.9 8.2 YKR054c 26.9 8.4 > Hs4557709 Length=3110 Score = 35.0 bits (79), Expect = 0.031, Method: Composition-based stats. Identities = 23/52 (44%), Positives = 29/52 (55%), Gaps = 3/52 (5%) Query 24 KLGATLAELDKLRESN-ESLRSELDKMRKELEDKEAATHQELQERSSELAAA 74 KL TL D+ E N E L+ E+D+M KEL K T +E+ E EL AA Sbjct 1698 KLNETLGTRDEAFERNLEGLQKEIDQMIKELRRKNLETQKEIAE--DELVAA 1747 > CE08071 Length=818 Score = 33.1 bits (74), Expect = 0.12, Method: Composition-based stats. Identities = 18/44 (40%), Positives = 29/44 (65%), Gaps = 4/44 (9%) Query 28 TLAELDKLRESNESLRSELDKMRKELEDKEAATHQELQERSSEL 71 T +DKL+E NE L+S L+K R+E D+ H+++ E+S +L Sbjct 40 TKEAIDKLQEQNEDLKSILEKERQERNDQ----HKKIMEQSHQL 79 > CE02186 Length=340 Score = 31.6 bits (70), Expect = 0.38, Method: Composition-based stats. Identities = 13/32 (40%), Positives = 21/32 (65%), Gaps = 0/32 (0%) Query 29 LAELDKLRESNESLRSELDKMRKELEDKEAAT 60 ++ELD+LR+ E L+S++ + RK D AT Sbjct 1 MSELDQLRQEAEQLKSQIREARKSANDTTLAT 32 > 7290500 Length=437 Score = 30.8 bits (68), Expect = 0.70, Method: Compositional matrix adjust. Identities = 17/40 (42%), Positives = 25/40 (62%), Gaps = 9/40 (22%) Query 28 TLAELDKLRESNESLRSELDKMRKELEDKEAATHQELQER 67 L E D LR SN++LR ELD+++++ Q+LQER Sbjct 352 CLRETDSLRASNQALREELDRLKRQ---------QQLQER 382 > Hs6005904 Length=1093 Score = 29.6 bits (65), Expect = 1.4, Method: Compositional matrix adjust. Identities = 18/39 (46%), Positives = 25/39 (64%), Gaps = 1/39 (2%) Query 18 LVEVQEK-LGATLAELDKLRESNESLRSELDKMRKELED 55 +VE QEK LG ++D+L E N S+++ LD KEL D Sbjct 631 MVERQEKDLGRLQVDMDELEEKNRSIQAALDSAYKELTD 669 > At4g24520 Length=692 Score = 28.9 bits (63), Expect = 2.3, Method: Compositional matrix adjust. Identities = 20/46 (43%), Positives = 26/46 (56%), Gaps = 3/46 (6%) Query 16 RRLVEVQEKLGATLAEL-DKLRESNESLRSELDKMRKELEDKEAAT 60 +RL+EV LG + D ESL SELDK+ K+ +DK AT Sbjct 209 KRLIEV--GLGDDDQSIEDDFNAWKESLWSELDKLLKDEDDKSVAT 252 > 7297839_2 Length=1197 Score = 28.9 bits (63), Expect = 2.4, Method: Compositional matrix adjust. Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 4/58 (6%) Query 14 VTRRLVEVQEKLGATLAELDKLRESNESLRSELDKMRKELEDKEAATHQELQERSSEL 71 + +R++E++EK + ELDK R SL SE+ K E + T ++LQE +E+ Sbjct 694 LAKRIIELEEKCDQQVLELDKCRLEKLSLESEIQKANSE----HSCTMEKLQELQAEM 747 > Hs13699824 Length=1056 Score = 28.5 bits (62), Expect = 3.4, Method: Compositional matrix adjust. Identities = 18/53 (33%), Positives = 33/53 (62%), Gaps = 3/53 (5%) Query 17 RLVEVQEKLGATLAELDKLRESNESLRSELDKMRKELEDKEA---ATHQELQE 66 ++VE+ EK+GA EL+++ E ++ELD+ + +L++K T + LQE Sbjct 418 QIVELIEKIGAVEEELNRVTELFMDNKNELDQCKSDLQNKTQELETTQKHLQE 470 > Hs21264594 Length=876 Score = 28.5 bits (62), Expect = 3.5, Method: Compositional matrix adjust. Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 8/71 (11%) Query 8 LTKIPSVTR-RLVEVQEKLGATLAELDKLRESNESLRSELDKMR-KELEDKEAATHQELQ 65 +TK P + L+ +Q + ATLA R++ ES R+EL+++R E DKE+ L+ Sbjct 725 ITKNPKIGGLPLIPIQHEGNATLA-----RKNIESARAELERLRLSEKCDKESVD-SSLK 778 Query 66 ERSSELAAARE 76 ER+S +A E Sbjct 779 ERASMVAHCLE 789 > At1g59620 Length=842 Score = 28.5 bits (62), Expect = 3.5, Method: Compositional matrix adjust. Identities = 14/27 (51%), Positives = 20/27 (74%), Gaps = 1/27 (3%) Query 36 RESNESLRSELDKMRKELEDKEAATHQ 62 ++ NE LRS+L+K+R LED +A HQ Sbjct 29 KQFNE-LRSDLNKLRCFLEDADAKKHQ 54 > Hs7706639 Length=805 Score = 28.1 bits (61), Expect = 3.8, Method: Composition-based stats. Identities = 19/74 (25%), Positives = 37/74 (50%), Gaps = 6/74 (8%) Query 5 ELQLTKIPSVTRRLVEVQEK---LGATLAELDKLRESNESL-RSELDKMRKELEDKEAAT 60 E+Q + R L + + L AT + D R+ N L E +KMR++LE++ A Sbjct 615 EIQFEDFTNTLRELGHAEHEITELTATFTKFD--RDGNRILDEKEQEKMRQDLEEERVAL 672 Query 61 HQELQERSSELAAA 74 + E+++ + ++ Sbjct 673 NTEIEKLGRSIVSS 686 > Hs21264592 Length=1704 Score = 28.1 bits (61), Expect = 3.8, Method: Compositional matrix adjust. Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 8/71 (11%) Query 8 LTKIPSVTR-RLVEVQEKLGATLAELDKLRESNESLRSELDKMR-KELEDKEAATHQELQ 65 +TK P + L+ +Q + ATLA R++ ES R+EL+++R E DKE+ L+ Sbjct 1553 ITKNPKIGGLPLIPIQHEGNATLA-----RKNIESARAELERLRLSEKCDKESVD-SSLK 1606 Query 66 ERSSELAAARE 76 ER+S +A E Sbjct 1607 ERASMVAHCLE 1617 > HsM16975482 Length=1704 Score = 28.1 bits (61), Expect = 3.8, Method: Compositional matrix adjust. Identities = 26/71 (36%), Positives = 41/71 (57%), Gaps = 8/71 (11%) Query 8 LTKIPSVTR-RLVEVQEKLGATLAELDKLRESNESLRSELDKMR-KELEDKEAATHQELQ 65 +TK P + L+ +Q + ATLA R++ ES R+EL+++R E DKE+ L+ Sbjct 1553 ITKNPKIGGLPLIPIQHEGNATLA-----RKNIESARAELERLRLSEKCDKESVD-SSLK 1606 Query 66 ERSSELAAARE 76 ER+S +A E Sbjct 1607 ERASMVAHCLE 1617 > 7290995 Length=821 Score = 28.1 bits (61), Expect = 3.8, Method: Compositional matrix adjust. Identities = 15/42 (35%), Positives = 27/42 (64%), Gaps = 4/42 (9%) Query 31 ELDKLRESNESLRSELDKMRKELEDKEAATHQELQERSSELA 72 +LD R+S++ L+ ++D +R +LED E + ER+ E+A Sbjct 468 QLDLARDSSQGLQQQVDALRHQLEDSE----WRVCERNGEIA 505 > Hs18563640 Length=435 Score = 28.1 bits (61), Expect = 3.9, Method: Compositional matrix adjust. Identities = 11/22 (50%), Positives = 20/22 (90%), Gaps = 0/22 (0%) Query 34 KLRESNESLRSELDKMRKELED 55 KLRE NE+L++E+D++R E+++ Sbjct 222 KLREENETLKNEIDELRTEMDE 243 > At1g03080 Length=1744 Score = 28.1 bits (61), Expect = 4.1, Method: Compositional matrix adjust. Identities = 19/37 (51%), Positives = 23/37 (62%), Gaps = 1/37 (2%) Query 40 ESLRSELDKMRKELEDKEAATHQELQERSSELAAARE 76 ESL S +D MRK +ED E H EL+ + ELA RE Sbjct 779 ESLLSHIDTMRKRIEDLE-KEHAELKVKVLELATERE 814 > CE25049 Length=3704 Score = 28.1 bits (61), Expect = 4.2, Method: Composition-based stats. Identities = 17/76 (22%), Positives = 37/76 (48%), Gaps = 0/76 (0%) Query 1 SLATELQLTKIPSVTRRLVEVQEKLGATLAELDKLRESNESLRSELDKMRKELEDKEAAT 60 ++A LQLTK+ ++ + + E++ A E KL + ++ L R+E+ Sbjct 2361 NIAKMLQLTKVENLVAAITDDLERVEAAKGEFQKLNVAIGNITENLKDKREEMTHAVTTL 2420 Query 61 HQELQERSSELAAARE 76 ++ + + L AA++ Sbjct 2421 NETRNDVAEALEAAKK 2436 > At1g63300 Length=1029 Score = 28.1 bits (61), Expect = 4.3, Method: Compositional matrix adjust. Identities = 13/28 (46%), Positives = 19/28 (67%), Gaps = 0/28 (0%) Query 23 EKLGATLAELDKLRESNESLRSELDKMR 50 E +G +AE++ LRE N S+ EL +MR Sbjct 969 EDIGVLVAEIESLRECNGSMEMELKEMR 996 > Hs21237794 Length=471 Score = 28.1 bits (61), Expect = 4.3, Method: Compositional matrix adjust. Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 0/51 (0%) Query 8 LTKIPSVTRRLVEVQEKLGATLAELDKLRESNESLRSELDKMRKELEDKEA 58 L+ P + +EV+ L A+ A++ +L + N +L EL M+K+L K+A Sbjct 420 LSDGPVTVQEFMEVKNALVASEAKIQQLMKVNNNLSDELRIMQKKLLGKDA 470 > HsM7661944 Length=471 Score = 28.1 bits (61), Expect = 4.4, Method: Compositional matrix adjust. Identities = 17/51 (33%), Positives = 30/51 (58%), Gaps = 0/51 (0%) Query 8 LTKIPSVTRRLVEVQEKLGATLAELDKLRESNESLRSELDKMRKELEDKEA 58 L+ P + +EV+ L A+ A++ +L + N +L EL M+K+L K+A Sbjct 420 LSDGPVTVQEFMEVKNALVASEAKIQQLMKVNNNLSDELRIMQKKLLGKDA 470 > CE17275 Length=1808 Score = 28.1 bits (61), Expect = 4.5, Method: Composition-based stats. Identities = 15/65 (23%), Positives = 40/65 (61%), Gaps = 1/65 (1%) Query 10 KIPSVTRRLVEVQEKLGATLAELDKLRESNESLRSELDKMRKELEDKEAATHQELQERSS 69 K+ + ++++ +EKLGA + + ++ + + +L+ ++KE++ AT EL++++S Sbjct 1282 KLALLKKQVIAGREKLGAIETRISNITQAVDFAQKDLEHLQKEVDKVTKAT-IELEDKAS 1340 Query 70 ELAAA 74 ++ A Sbjct 1341 KIKEA 1345 > 7299228 Length=387 Score = 27.7 bits (60), Expect = 5.1, Method: Composition-based stats. Identities = 16/49 (32%), Positives = 28/49 (57%), Gaps = 0/49 (0%) Query 4 TELQLTKIPSVTRRLVEVQEKLGATLAELDKLRESNESLRSELDKMRKE 52 T L+ TKIP +T+R V K+ + D + ++++ R+ L K RK+ Sbjct 51 TFLRRTKIPELTQRDFFVGSKINVFGRQFDIVDYADDTTRTNLAKYRKK 99 > YGR089w Length=936 Score = 27.7 bits (60), Expect = 5.3, Method: Composition-based stats. Identities = 14/38 (36%), Positives = 24/38 (63%), Gaps = 0/38 (0%) Query 17 RLVEVQEKLGATLAELDKLRESNESLRSELDKMRKELE 54 R +V ++L ++LDKL NE L+ E+D+ +E+E Sbjct 842 RFQKVNQELVQLGSKLDKLNARNEKLQKEVDQNAEEIE 879 > Hs4502767 Length=281 Score = 27.7 bits (60), Expect = 5.4, Method: Compositional matrix adjust. Identities = 15/35 (42%), Positives = 23/35 (65%), Gaps = 0/35 (0%) Query 16 RRLVEVQEKLGATLAELDKLRESNESLRSELDKMR 50 RR++E Q+K+ +AE ++LR E L ELD +R Sbjct 227 RRILETQQKVLEYMAENERLRSRVEQLTQELDTLR 261 > CE19350 Length=404 Score = 27.7 bits (60), Expect = 5.4, Method: Composition-based stats. Identities = 14/57 (24%), Positives = 34/57 (59%), Gaps = 2/57 (3%) Query 20 EVQEKLGATLAELDKLRESNESLRSELDKMRKELEDKEAATHQELQERSSELAAARE 76 +++E++G AE+ +R +++ LR K+++ LE+ E T + + + E+ A++ Sbjct 266 KLRERMGTNSAEMASIRTTSDELREGQQKLKRMLEELE--TQRSSLQTACEIYTAKK 320 > At5g42570 Length=252 Score = 27.7 bits (60), Expect = 5.6, Method: Compositional matrix adjust. Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 0/36 (0%) Query 27 ATLAELDKLRESNESLRSELDKMRKELEDKEAATHQ 62 L E D+L E N++LR++L+ + E K+ HQ Sbjct 186 GFLMEYDRLLEDNQNLRNQLESIGHSPEGKKEVKHQ 221 > SPAC186.05c Length=262 Score = 27.3 bits (59), Expect = 6.7, Method: Composition-based stats. Identities = 12/29 (41%), Positives = 20/29 (68%), Gaps = 0/29 (0%) Query 29 LAELDKLRESNESLRSELDKMRKELEDKE 57 L E ++RES +SL +E DK+ K + ++E Sbjct 106 LKESKEVRESQQSLENEFDKVEKIIVNEE 134 > CE07133 Length=443 Score = 27.3 bits (59), Expect = 7.5, Method: Compositional matrix adjust. Identities = 14/40 (35%), Positives = 27/40 (67%), Gaps = 0/40 (0%) Query 18 LVEVQEKLGATLAELDKLRESNESLRSELDKMRKELEDKE 57 +++++E+ ELDKL E+ +LR+E++ RK +E+ E Sbjct 363 VIKMREECTKLSVELDKLVENQINLRNEINHYRKLMENAE 402 > CE05442 Length=372 Score = 26.9 bits (58), Expect = 8.2, Method: Compositional matrix adjust. Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 0/39 (0%) Query 15 TRRLVEVQEKLGATLAELDKLRESNESLRSELDKMRKEL 53 +R++ EV++KL A D+L++ + L EL K R EL Sbjct 78 SRKIAEVEKKLNAIQITKDRLKDRADKLSGELTKTRVEL 116 > Hs17485914 Length=610 Score = 26.9 bits (58), Expect = 8.2, Method: Compositional matrix adjust. Identities = 12/28 (42%), Positives = 20/28 (71%), Gaps = 0/28 (0%) Query 27 ATLAELDKLRESNESLRSELDKMRKELE 54 A +++ + L+E N+SLR +LD R E+E Sbjct 406 ALVSQAEALKEENDSLRWQLDAYRNEVE 433 > YKR054c Length=4092 Score = 26.9 bits (58), Expect = 8.4, Method: Compositional matrix adjust. Identities = 15/62 (24%), Positives = 31/62 (50%), Gaps = 0/62 (0%) Query 5 ELQLTKIPSVTRRLVEVQEKLGATLAELDKLRESNESLRSELDKMRKELEDKEAATHQEL 64 ++Q+ + SV R L +++ + + +D+L SLR L + +EL+ + L Sbjct 1091 DIQIKLLGSVMRALTKLKVRFPSHFVYIDQLDNDFSSLRQSLSYVEQELQKHRVVIAKSL 1150 Query 65 QE 66 +E Sbjct 1151 EE 1152 Lambda K H 0.303 0.119 0.284 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1178249128 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40