bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eace_2490_orf1 Length=105 Score E Sequences producing significant alignments: (Bits) Value YBR203w 28.5 3.3 At3g05200 28.1 4.6 CE23986 27.7 5.6 > YBR203w Length=924 Score = 28.5 bits (62), Expect = 3.3, Method: Composition-based stats. Identities = 15/34 (44%), Positives = 18/34 (52%), Gaps = 0/34 (0%) Query 46 KFDLVVSPYRVLPKEGTLEAAGLCPNCVVLLMEN 79 KF L +PY+ LP L LCPN V L + N Sbjct 534 KFLLKYAPYKDLPLGYILHMLNLCPNLVELNLSN 567 > At3g05200 Length=392 Score = 28.1 bits (61), Expect = 4.6, Method: Compositional matrix adjust. Identities = 19/55 (34%), Positives = 28/55 (50%), Gaps = 3/55 (5%) Query 31 CVAEYCELPSLRIPAKFDLVVSPYRVLPKEGTLEAAGLCPNCVVLLMENESETES 85 C+ E+ + +LR+ K D V P+ + + LEA CP C L E +E ES Sbjct 125 CLNEFEDDETLRLLPKCDHVFHPHCI---DAWLEAHVTCPVCRANLAEQVAEGES 176 > CE23986 Length=1142 Score = 27.7 bits (60), Expect = 5.6, Method: Composition-based stats. Identities = 11/25 (44%), Positives = 17/25 (68%), Gaps = 0/25 (0%) Query 4 LKLACGKRITRIFSSSSSLSLLYRW 28 LK+ACGK++T+I LS L ++ Sbjct 412 LKVACGKQMTKILVGKDGLSYLLQY 436 Lambda K H 0.318 0.129 0.383 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1170944580 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40