bitscore colors: <40, 40-50 , 50-80, 80-200, >200
BLASTP 2.2.24+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for composition-based statistics: Alejandro A. Schaffer, L. Aravind, Thomas L. Madden, Sergei Shavirin, John L. Spouge, Yuri I. Wolf, Eugene V. Koonin, and Stephen F. Altschul (2001), "Improving the accuracy of PSI-BLAST protein database searches with composition-based statistics and other refinements", Nucleic Acids Res. 29:2994-3005. Database: kyva 112,920 sequences; 47,500,486 total letters Query= Eten_0010_orf5 Length=147 Score E Sequences producing significant alignments: (Bits) Value Hs22052008 28.9 3.8 Hs18550690 28.5 4.5 > Hs22052008 Length=480 Score = 28.9 bits (63), Expect = 3.8, Method: Composition-based stats. Identities = 12/37 (32%), Positives = 20/37 (54%), Gaps = 0/37 (0%) Query 86 YTSVPPDPKHPSMRSLAPEAAAAAVSTHLLSCCCCGV 122 Y P+P PS++ + PE+ + A+ HL+ C V Sbjct 336 YLQTLPEPILPSLQKIYPESFSPAIQLHLVHQAPCNV 372 > Hs18550690 Length=630 Score = 28.5 bits (62), Expect = 4.5, Method: Compositional matrix adjust. Identities = 19/52 (36%), Positives = 20/52 (38%), Gaps = 10/52 (19%) Query 34 VCPPPQLLQLGCLYTSSAAAPEVPVHLKSCCSWGVYTPQHLLRLLLLQLGCL 85 VCPPP +Q G PEVPVH SW R L CL Sbjct 400 VCPPPTQIQ-GWRGAPGRVRPEVPVHPSDNQSW---------RFTLRGFSCL 441 Lambda K H 0.325 0.137 0.474 Gapped Lambda K H 0.267 0.0410 0.140 Effective search space used: 1785281974 Database: kyva Posted date: Jul 3, 2009 9:03 AM Number of letters in database: 47,500,486 Number of sequences in database: 112,920 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Neighboring words threshold: 11 Window for multiple hits: 40